PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G168900.1.p
Common NameLOC101758178, SETIT_030592mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 314aa    MW: 34223.7 Da    PI: 6.4414
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G168900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.31.7e-3346100155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         ++rlrWt+eLHerFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Seita.2G168900.1.p  46 RQRLRWTNELHERFVEAVTQLGGPDRATPKGVLRIMGVPGLTIYHVKSHLQKYRL 100
                         58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.32643103IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-3245101IPR009057Homeodomain-like
SuperFamilySSF466893.23E-1845100IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-2647101IPR006447Myb domain, plants
PfamPF002494.4E-94899IPR001005SANT/Myb domain
PfamPF143791.4E-23133178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MYSPKPEASF GSTHTNSVAN QQQMELAGNN MGPSNGANNN NNLAARQRLR WTNELHERFV  60
EAVTQLGGPD RATPKGVLRI MGVPGLTIYH VKSHLQKYRL AKYIPDASTD GNKADNKDPG  120
DLLAGLEGSS GLPISEALKL QMEVQKRLHE QLEVQRQLQL RIEAQGKYLQ KIIEEQQRLT  180
GVKSETPAAG ASVTVSSDQF PDSERTEPST PAPTSESPTQ VGASNRDTGE RAEATKSTCH  240
GDSLSRHEPL TPDSNCQNGS PPASPNHERA AKRQRGSGNE FVDVETDFSH PRHIFESSLG  300
PEFEQYSMSY SGH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0332050.0BT033205.1 Zea mays full-length cDNA clone ZM_BFb0066I21 mRNA, complete cds.
GenBankBT0398990.0BT039899.1 Zea mays full-length cDNA clone ZM_BFc0050C09 mRNA, complete cds.
GenBankBT0411540.0BT041154.1 Zea mays full-length cDNA clone ZM_BFc0181P18 mRNA, complete cds.
GenBankBT0858910.0BT085891.1 Zea mays full-length cDNA clone ZM_BFc0076P02 mRNA, complete cds.
GenBankBT0863350.0BT086335.1 Zea mays full-length cDNA clone ZM_BFc0154D10 mRNA, complete cds.
GenBankEU9764460.0EU976446.1 Zea mays clone 894637 MYB-CC type transfactor mRNA, complete cds.
GenBankJX4699000.0JX469900.1 Zea mays subsp. mays clone UT3140 G2-like transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956515.10.0PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ8GUN53e-51PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLK3ZVG10.0K3ZVG1_SETIT; Uncharacterized protein
STRINGSi030592m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22203896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.16e-74G2-like family protein